Scaffold Ga0208050_1026092

Overview

Basic Information

• Taxon OID: 3300020498
• Scaffold ID: Ga0208050_1026092
• Source Dataset Name: Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 591
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Lake Mendota, Madison, Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.099444
  • Long. (^o): -89.404444

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018927	Metagenome	232	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208050_10260921	F018927	GAGG	MNKHIEITRHLTVDGTSTYYVVEKSKNSSSIIWNGTCKQAAYQVAYRNARKENTPLYDTLYKAEVDRN