NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208230_1000769

Scaffold Ga0208230_1000769


Overview

Basic Information
Taxon OID3300020496 Open in IMG/M
Scaffold IDGa0208230_1000769 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 01NOV2011 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4497
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (14.29%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024267Metagenome / Metatranscriptome206Y
F028780Metagenome / Metatranscriptome190N
F040591Metagenome / Metatranscriptome161Y

Sequences

Protein IDFamilyRBSSequence
Ga0208230_10007694F040591N/AMKIKDEYKGKTIVKNTTLGNMTVVVDNIDVNRYRYYVSIGFGYLFEKETTTAPEQCIRYEGIEADEQTEAPRAEPTPKRKRKTNAKANTKRNQG
Ga0208230_10007695F028780N/AMKATLDRYISSHYEELYRYTRYFCSKYNPKLTIDTVISNAYLHCLEINDNTEDVGKVKSYILNSIKRQVIWKNVNSFKDERILASEIAVPDTFDDGEDLNYKIAIEQQYQGWKSSVDIYRDGLTDNVKIAVANAYFDKGLTTARSMAQYFKIPNTSAHYLIADIKNTLKSIHYENKR
Ga0208230_10007699F024267N/AMKIEITHYGHKASYEFEHEDVELEDLIYHIEQLIRLTGYSINGTLEIVNEEQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.