NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208698_104220

Scaffold Ga0208698_104220


Overview

Basic Information
Taxon OID3300020486 Open in IMG/M
Scaffold IDGa0208698_104220 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 20AUG2008 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1251
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.099444Long. (o)-89.404444Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000852Metagenome / Metatranscriptome860Y
F009685Metagenome / Metatranscriptome314Y
F013414Metagenome / Metatranscriptome271Y

Sequences

Protein IDFamilyRBSSequence
Ga0208698_1042202F013414AGGCGGMSKTREIKVAEDLVNLTEDHWFNPAILARYLTDQPFYTVDRIMELVAQIIRWQANRHNDELNTEDGIYNSGQSSEGLFLANELNETLNRLIKTYKWENIKLPVDPAKFIKKMPKVETQSYRHSWLHDTDTRTHVTIDHPFI
Ga0208698_1042203F000852AGGAMTTKREYLKSQGITVGVRGRFSGAAKVAIQEAMNKGVTFTDPQPVTNKAK
Ga0208698_1042205F009685N/AKKMKMSDQYVDSVLAEAQKLLWGGSETENIEAHNLIAKLIKDRLVDESV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.