Scaffold Ga0211541_10536736

Overview

Basic Information

• Taxon OID: 3300020475
• Scaffold ID: Ga0211541_10536736
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 571
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_152
• Coordinates
  • Lat. (^o): 43.7738
  • Long. (^o): -16.9097
  • Depth (m): 5 to 160

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017320	Metagenome / Metatranscriptome	241	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211541_105367361	F017320	N/A	IPTSITENIANKYFDILDEGGSKKYKVTSIIPEIIIILKIVPNPGFCLRNIHKKRTLTLTKNVAAPIDNLEFFDIPSASTDQGEFPVVDNINNPSPKPKIIKPKIKKNDVENFGLKLKLLSELQYTLGIFLIDKNILYC