Basic Information | |
---|---|
Taxon OID | 3300020474 Open in IMG/M |
Scaffold ID | Ga0211547_10103112 Open in IMG/M |
Source Dataset Name | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1495 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_151 | |||||||
Coordinates | Lat. (o) | 36.139 | Long. (o) | -28.9598 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F087891 | Metagenome | 110 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211547_101031125 | F087891 | AGGAG | MNNYYVAVSDITFYLYDEDGNAKTDKSGNEITYRLKDGIRYKPLEYIADGVEVNMLQKIKEKQ |
⦗Top⦘ |