Scaffold Ga0211625_10219850

Overview

Basic Information

• Taxon OID: 3300020473
• Scaffold ID: Ga0211625_10219850
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1001
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_122
• Coordinates
  • Lat. (^o): -8.9632
  • Long. (^o): -139.2276
  • Depth (m): 115

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036917	Metagenome	169	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211625_102198502	F036917	N/A	MSNYLIINTTTNIVENNVVWDGDTDKWNPPTGSIAIASTEGGINWKYNSGGVGVGTTSGDTTKMWIPQIGSGTTV