NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211614_10250557

Scaffold Ga0211614_10250557


Overview

Basic Information
Taxon OID3300020471 Open in IMG/M
Scaffold IDGa0211614_10250557 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)772
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_052
CoordinatesLat. (o)-16.9675Long. (o)53.9199Alt. (m)Depth (m)75
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007227Metagenome / Metatranscriptome355Y
F011088Metagenome / Metatranscriptome295Y

Sequences

Protein IDFamilyRBSSequence
Ga0211614_102505572F011088GGAMFVVPEYTCKHPIFPHHNTVDLMYDAINNGCERHDWYAYLDFISENQYDFGGG
Ga0211614_102505573F007227N/ARKMSLLNPHDHHMLYVRDDGSFYGFTHMKGEDPEEWFWEAHGIQTELFPPEPPKSHQFTQEQLDRAPHHNMLEKYYGKDWVVKPVEGLGDHY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.