| Basic Information | |
|---|---|
| Taxon OID | 3300020471 Open in IMG/M |
| Scaffold ID | Ga0211614_10241668 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 786 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_052 | |||||||
| Coordinates | Lat. (o) | -16.9675 | Long. (o) | 53.9199 | Alt. (m) | Depth (m) | 75 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029554 | Metagenome | 188 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211614_102416681 | F029554 | GGAGG | MASKMLREIVEDDLTPKKSDKIESSNDFYERLRDPDDGFDNEIESYEVITEYR |
| ⦗Top⦘ |