Scaffold Ga0211543_10152226

Overview

Basic Information

• Taxon OID: 3300020470
• Scaffold ID: Ga0211543_10152226
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1160
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_041
• Coordinates
  • Lat. (^o): 14.5375
  • Long. (^o): 70.0244
  • Depth (m): 60

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010689	Metagenome	300	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211543_101522261	F010689	N/A	MIPEMIDFQGKKWVVRAKLEERKVDDHTKLKSNYDADLVLKNNQGWFFVLDEVIDAEFE