NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211543_10012615

Scaffold Ga0211543_10012615


Overview

Basic Information
Taxon OID3300020470 Open in IMG/M
Scaffold IDGa0211543_10012615 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4899
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (14.29%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_041
CoordinatesLat. (o)14.5375Long. (o)70.0244Alt. (m)Depth (m)60
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018738Metagenome / Metatranscriptome233Y

Sequences

Protein IDFamilyRBSSequence
Ga0211543_100126151F018738N/AIMTLYRYYCADTECGKHFCLMASDDMEAAYRADSMAKEWYNTTLKDVYLDKHANPNRRYRPYDKEILSQQL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.