Scaffold Ga0211577_10252892

Overview

Basic Information

• Taxon OID: 3300020469
• Scaffold ID: Ga0211577_10252892
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1135
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_133
• Coordinates
  • Lat. (^o): 35.4068
  • Long. (^o): -127.7432
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101343	Metagenome	102	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211577_102528922	F101343	N/A	MKSLLIKIGVGISLGVNLTVFSYILYNSKMYDKRVDENRKFIKETIIEEVYKQIKFVMPKESGGVNVGSK