Scaffold Ga0211475_10047203

Overview

Basic Information

• Taxon OID: 3300020468
• Scaffold ID: Ga0211475_10047203
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2354
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_018
• Coordinates
  • Lat. (^o): 35.7392
  • Long. (^o): 14.3321
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035538	Metagenome	172	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211475_100472037	F035538	N/A	TIEHAGEAKYTAIFSINADAPDIMTGLFVELVEGEMDDEDNLKVVFNRVLAQFVNSRRPSSMQTNENLVRTWKGFLNS