| Basic Information | |
|---|---|
| Taxon OID | 3300020467 Open in IMG/M |
| Scaffold ID | Ga0211713_10556114 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 558 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_112 | |||||||
| Coordinates | Lat. (o) | -23.1569 | Long. (o) | -129.5943 | Alt. (m) | Depth (m) | 155 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003612 | Metagenome | 477 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211713_105561142 | F003612 | N/A | NFAGAEVDFFHITFITSDGSTVLDVRTELGYDETLHNVQRAILQRGTILYQRIEDGATGRMDICMERSGWTAATLQTAIRALGTSVGTNNKDVSQSTVTETELKLDNS |
| ⦗Top⦘ |