Basic Information | |
---|---|
Taxon OID | 3300020467 Open in IMG/M |
Scaffold ID | Ga0211713_10076686 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1621 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_112 | |||||||
Coordinates | Lat. (o) | -23.1569 | Long. (o) | -129.5943 | Alt. (m) | Depth (m) | 155 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F097489 | Metagenome / Metatranscriptome | 104 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211713_100766862 | F097489 | GGGGG | MNNNIFLTNEAARKDPVVVAAMKSILKQMSDEHDRHVAGIAPQTREVSPVNFLQDVLDDLGDPQFRNREREEYFRNGWGDSVNGVWQ |
⦗Top⦘ |