Scaffold Ga0211640_10298615

Overview

Basic Information

• Taxon OID: 3300020465
• Scaffold ID: Ga0211640_10298615
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 894
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_111
• Coordinates
  • Lat. (^o): -16.9687
  • Long. (^o): -100.7324
  • Depth (m): 90

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044479	Metagenome	154	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211640_102986152	F044479	AGGAGG	MDAGSLNGLVEYGILGMWTLSLLISNHSMKGNFQARYDDLNKNVVEVVKKNKELAEENQEKLEKALDKIDEGLQTMKQKYMEDKLRAELAFKDTRV