| Basic Information | |
|---|---|
| Taxon OID | 3300020459 Open in IMG/M |
| Scaffold ID | Ga0211514_10494194 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 601 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_004 | |||||||
| Coordinates | Lat. (o) | 35.5571 | Long. (o) | -6.5586 | Alt. (m) | Depth (m) | 40 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001942 | Metagenome / Metatranscriptome | 613 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211514_104941942 | F001942 | N/A | MGNKTSEDHQANSRLGALGESLVQTFLLEHCDWCYKTQEKHPADLMVELGSAKYTIQVKSRRETKKGKYVFATETSRSLSDVYKHYHCDIFAFVFFDNSGKYILFKPNNTTQTYFSFDSSIITPTLAMDSFKETLDQLSSVPKINPLLK |
| ⦗Top⦘ |