Scaffold Ga0211514_10324611

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211514_10324611

Scaffold Ga0211514_10324611

Overview

Basic Information
Taxon OID	3300020459 Open in IMG/M
Scaffold ID	Ga0211514_10324611 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	757
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	TARA_004
Coordinates	Lat. (^o)	35.5571	Long. (^o)	-6.5586	Alt. (m)		Depth (m)	40
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008152	Metagenome	338	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211514_103246112	F008152	AGGA	MKYDPLGWYKDQICRMTWDEILELMEERISNGSWNKFVESLEKPPHVIKHDYMLEQMKK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.