| Basic Information | |
|---|---|
| Taxon OID | 3300020458 Open in IMG/M |
| Scaffold ID | Ga0211697_10443476 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000749 (ERX556123-ERR599000) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 541 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_076 | |||||||
| Coordinates | Lat. (o) | -20.9724 | Long. (o) | -35.2742 | Alt. (m) | Depth (m) | 800 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028944 | Metagenome / Metatranscriptome | 190 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211697_104434761 | F028944 | AGAAG | MSEDDTYRNRDYQRTRASREMADKRMKLVKESKFSFLSAIIDHYAYLMDLKKEEFNFEYNTYMSHIRYTSRKKFKRQHDKILEMALMKACSEHYDDFNDNNLANFVKTYITSQTMRM |
| ⦗Top⦘ |