Scaffold Ga0211643_10553256

Overview

Basic Information

• Taxon OID: 3300020457
• Scaffold ID: Ga0211643_10553256
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 565
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_110
• Coordinates
  • Lat. (^o): -1.8505
  • Long. (^o): -84.6318
  • Depth (m): 50

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095450	Metagenome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211643_105532561	F095450	N/A	MSKIKLNKVEVKVSKVETVKVDGRKNNPGRPVNKKSARYIRLQKQAFYADVNAKFKQGNQFKINNSTYKYSAGKLDLGCIVDMFTGSHVCNVDYIGRTKVQGYAFVLGKKVNVELNLKTLKFVS