| Basic Information | |
|---|---|
| Taxon OID | 3300020456 Open in IMG/M |
| Scaffold ID | Ga0211551_10457580 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100001741 (ERX555984-ERR599123) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 608 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_148 | |||||||
| Coordinates | Lat. (o) | 31.8366 | Long. (o) | -64.109 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016324 | Metagenome | 248 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211551_104575801 | F016324 | GGTGG | MHNSVRRPPLRPPKIGDVVRLSGPGGMGRTYTKVHGVGIVTGIHKPEHARKLYEVKWLKSEERMRFHEEDLIIVSDV |
| ⦗Top⦘ |