Scaffold Ga0211551_10127219

Overview

Basic Information

• Taxon OID: 3300020456
• Scaffold ID: Ga0211551_10127219
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001741 (ERX555984-ERR599123)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1202
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas pusilla (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_148
• Coordinates
  • Lat. (^o): 31.8366
  • Long. (^o): -64.109
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062730	Metagenome / Metatranscriptome	130	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211551_101272192	F062730	N/A	MGTETPVGYRLVRVGVRGRVPTLHTRAPEDLTTRQKYDLRYREKHRAKLLAYHREYYRKKRTQ