| Basic Information | |
|---|---|
| Taxon OID | 3300020455 Open in IMG/M |
| Scaffold ID | Ga0211664_10212797 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000965 (ERX555917-ERR599081) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 899 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_100 | |||||||
| Coordinates | Lat. (o) | -12.9226 | Long. (o) | -96.0932 | Alt. (m) | Depth (m) | 50 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F022899 | Metagenome | 212 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211664_102127971 | F022899 | N/A | YTRHGRSPLTNEHLHSLDCLYQAYTQEGISEGDKRFYWAKIQQLTNTYTERNRGTV |
| ⦗Top⦘ |