Scaffold Ga0211548_10390846

Overview

Basic Information

• Taxon OID: 3300020454
• Scaffold ID: Ga0211548_10390846
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 680
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_150
• Coordinates
  • Lat. (^o): 35.8591
  • Long. (^o): -37.1728
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087438	Metagenome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211548_103908461	F087438	N/A	NVDNEYKNYWVLYQWLNLLHSEYEGRYNEREINTNAGDPTFKDYQTDLTIYGKDEFNNNRIKFTYTKAFPTTVNGVEYSYQNPDEITSGFTFVYSQLHTEVINF