NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211548_10280577

Scaffold Ga0211548_10280577


Overview

Basic Information
Taxon OID3300020454 Open in IMG/M
Scaffold IDGa0211548_10280577 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)811
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_150
CoordinatesLat. (o)35.8591Long. (o)-37.1728Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037421Metagenome / Metatranscriptome168Y
F043443Metagenome / Metatranscriptome156Y

Sequences

Protein IDFamilyRBSSequence
Ga0211548_102805772F037421AGGAGMSKRTEDRTYFRELIRRLKELRVSADNGEIIVPNDDEDILEFNELELPITPDLFRNMTSEEKEALFIWLNKENMPQA
Ga0211548_102805773F043443N/AVNDKLLELKRKKLQQQILYLRTELEETEWIFHDCLKEFDVEFRKYFKNPTEKKDKDIVAEPPEYDIPATDVNMVFKKIAKHTHPDKLINKDISDEEYDAKVDMYKEAQRSVKNRDWSKVVEIAKELGIDISDIKNDD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.