Scaffold Ga0211545_10047422

Overview

Basic Information

• Taxon OID: 3300020452
• Scaffold ID: Ga0211545_10047422
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2085
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade → Methylophilales bacterium HTCC2181 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_152
• Coordinates
  • Lat. (^o): 43.6906
  • Long. (^o): -16.8555
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043633	Metagenome / Metatranscriptome	156	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211545_100474223	F043633	N/A	MDFRKIILNFFSLLNTVYLGLVIYIEFFMENLTKGPYEIYYDLWMYVFVGYCAILIFNFAMFGKVTLWNLKSKK