Scaffold Ga0211473_10001160

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211473_10001160

Scaffold Ga0211473_10001160

Overview

Basic Information
Taxon OID	3300020451 Open in IMG/M
Scaffold ID	Ga0211473_10001160 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	13601
Total Scaffold Genes	27 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	19 (70.37%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	TARA_150
Coordinates	Lat. (^o)	35.7956	Long. (^o)	-37.0998	Alt. (m)		Depth (m)	40
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030051	Metagenome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211473_1000116023	F030051	GGAG	MADPNSLSHFFENFTVSMVSVVIALIGFWTTFVKNLVSRKDVQDMIQNQSQYMKDREFIMDRLKDHKEDSATLFRALSKNTEVMSELKVQIALLSKTLEALEHRIERST

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.