Scaffold Ga0211642_10407395

Overview

Basic Information

• Taxon OID: 3300020449
• Scaffold ID: Ga0211642_10407395
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001079 (ERX556008-ERR599020)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 585
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED201 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_110
• Coordinates
  • Lat. (^o): -1.8191
  • Long. (^o): -84.6284
  • Depth (m): 380

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051968	Metagenome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211642_104073952	F051968	GAGG	MNIEEVTNMMCDFVAYVDDFYNEKSGIYPIIGMTDMMVIKAVQKHVATTGMEFCGDSLDREKVRDIILADNDVIWSAN