Scaffold Ga0211691_10047745

Overview

Basic Information

• Taxon OID: 3300020447
• Scaffold ID: Ga0211691_10047745
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1522
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → unclassified Nitrososphaerales → Nitrososphaerales archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_078
• Coordinates
  • Lat. (^o): -30.3455
  • Long. (^o): -43.2924
  • Depth (m): 800

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037766	Metagenome	167	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211691_100477452	F037766	AGGA	MPKRATLEILDAGEKIFGSPTGGKYFVQEFEDDVPKGGSFFKTIQEAEKHMVEYEAGDQTDTKVLLQE