Scaffold Ga0211574_10467311

Overview

Basic Information

• Taxon OID: 3300020446
• Scaffold ID: Ga0211574_10467311
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 543
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Cercozoa → Imbricatea → Silicofilosea → Euglyphida → Paulinellidae → Paulinella → Paulinella micropora (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_137
• Coordinates
  • Lat. (^o): 14.2017
  • Long. (^o): -116.6336
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004842	Metagenome / Metatranscriptome	421	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211574_104673111	F004842	N/A	VEKDSGKSTFDGEIFLLSHQLSTNGNNDATTGVFGTIPDIGAIKKVKKAINLLEVFILSDAISSLTLSRAPLLNNAAETANKPIKVINDGLPNPDKAFWGVNTPVAIKIATHNKPVSSGAIVFLINNIIDKNKTITVINAS