Basic Information | |
---|---|
Taxon OID | 3300020445 Open in IMG/M |
Scaffold ID | Ga0211564_10252614 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 871 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → PVC group → Kiritimatiellota → Kiritimatiellia → Kiritimatiellales → Kiritimatiellaceae → unclassified Kiritimatiellaceae → Kiritimatiellaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_138 | |||||||
Coordinates | Lat. (o) | 6.3354 | Long. (o) | -103.0345 | Alt. (m) | Depth (m) | 60 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F005193 | Metagenome / Metatranscriptome | 409 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211564_102526141 | F005193 | N/A | HSSDQLSVMDAYRINRLVKKLNELNTEYMELKNKLLTQFGTPGEKEGEFTVEGDSKEEFLKEFNELLGIEHDLETEMLPWPKKLEDGFSAADFNVMELFFNIDEVIMEEPKETVHLNKFNDAN |
⦗Top⦘ |