Scaffold Ga0211564_10216133

Overview

Basic Information

• Taxon OID: 3300020445
• Scaffold ID: Ga0211564_10216133
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 949
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_138
• Coordinates
  • Lat. (^o): 6.3354
  • Long. (^o): -103.0345
  • Depth (m): 60

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020260	Metagenome	225	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211564_102161332	F020260	N/A	MGKEKAKVEELTRKQRKELNSLAVVIAEEAINVRLDYEQSGSNLDSGSIVAIHQNSPLLDDEKEPLADVAYNIVRRKENEK