Basic Information | |
---|---|
Taxon OID | 3300020444 Open in IMG/M |
Scaffold ID | Ga0211578_10138376 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100001245 (ERX556114-ERR598980) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 959 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_132 | |||||||
Coordinates | Lat. (o) | 31.5319 | Long. (o) | -159.0668 | Alt. (m) | Depth (m) | 550 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051207 | Metagenome / Metatranscriptome | 144 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211578_101383761 | F051207 | GGA | MEGFIFKYIHTGSMASSIYIYTNRNDYDNLYKGKTEAYTYETPILDFFIRPTEGYDVADSIPTNRLWVVTQTDKVKMRPSLERSIVHFTNGTCFDFCCGNELQVEKEKVFYDPINNMLEFYPRRFRKPLLSLKVDRVVGGRP |
⦗Top⦘ |