NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211559_10593307

Scaffold Ga0211559_10593307


Overview

Basic Information
Taxon OID3300020442 Open in IMG/M
Scaffold IDGa0211559_10593307 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)500
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_140
CoordinatesLat. (o)7.416Long. (o)79.3102Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023490Metagenome210Y

Sequences

Protein IDFamilyRBSSequence
Ga0211559_105933072F023490N/ADYEKNTTDCNVTYHRNKIGNNYFVVFYKNMACIRLTPKDVGRVFGVAKFTPGVNGIREWCYQMVEKYGSEEDKDNEEYKKYIAKHGFGPEVHEEPNDNTKMIT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.