Scaffold Ga0211559_10029462

Overview

Basic Information

• Taxon OID: 3300020442
• Scaffold ID: Ga0211559_10029462
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2747
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_140
• Coordinates
  • Lat. (^o): 7.416
  • Long. (^o): 79.3102
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090422	Metagenome / Metatranscriptome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211559_100294622	F090422	GAGG	VSELREVDRVKKTLELCRDSLNNEIDAINPEDNSLPVDGLHWLISLEADCKDLVKYLSDYDSYDPG