Scaffold Ga0211518_10003063

Overview

Basic Information

• Taxon OID: 3300020440
• Scaffold ID: Ga0211518_10003063
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 12701
• Total Scaffold Genes: 17
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 15 (88.24%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_025
• Coordinates
  • Lat. (^o): 39.3599
  • Long. (^o): 19.4084
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093695	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211518_100030631	F093695	GGTGG	MMKRKLITYLGLGLLYMGKPFTSIGNWFWKKHKQVLDWND