Scaffold Ga0211558_10009501

Overview

Basic Information

• Taxon OID: 3300020439
• Scaffold ID: Ga0211558_10009501
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5063
• Total Scaffold Genes: 13
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (69.23%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_141
• Coordinates
  • Lat. (^o): 9.846
  • Long. (^o): 80.0607
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010536	Metagenome / Metatranscriptome	302	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211558_100095014	F010536	AGGAG	MADVKIIDVMVSKATEGMLIAELLNRRNDKEVPLFMGKSILLPNGKQQLIAILPNIQILTNVEQEEE