Scaffold Ga0211576_10325794

Overview

Basic Information

• Taxon OID: 3300020438
• Scaffold ID: Ga0211576_10325794
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 795
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_133
• Coordinates
  • Lat. (^o): 35.4118
  • Long. (^o): -127.7122
  • Depth (m): 45

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045552	Metagenome / Metatranscriptome	152	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211576_103257941	F045552	GAGG	MQTITQHEKDFVVEFLADTLHGLTMNNVLSRQDGDGFVRMADALEVMDNLSVLYNKHKDDGDWVNGATDATWTFTLSDAQDALQSYDTEYRECICEQFAEACTDASTDTANADLDC