Basic Information | |
---|---|
Taxon OID | 3300020438 Open in IMG/M |
Scaffold ID | Ga0211576_10095397 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1648 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_133 | |||||||
Coordinates | Lat. (o) | 35.4118 | Long. (o) | -127.7122 | Alt. (m) | Depth (m) | 45 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051138 | Metagenome | 144 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211576_100953975 | F051138 | GGA | MAKASKRQAFKESLSDTALAFAMNVPIGFGIIAFADWVGIVAVSYEENVQLVILQNIVFTTVAIIRKTYVRVWFENKRLKGLT |
⦗Top⦘ |