Scaffold Ga0211539_10241607

Overview

Basic Information

• Taxon OID: 3300020437
• Scaffold ID: Ga0211539_10241607
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 744
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_041
• Coordinates
  • Lat. (^o): 14.5
  • Long. (^o): 70.0
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024316	Metagenome / Metatranscriptome	206	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211539_102416072	F024316	AGGA	MKLSQIILEGPLEYDPDFNREVDKIQDQGGKYLGSGDYGSVYLLKGKAVKVTTDSIELDHAEKLKGKKTNNFVYIFDVKRLNEKLGIITMEVMGEYKGDIPEEFIIALEREASNYGIDPSELDIRPDNFMVHPKSGKIKMTDV