Scaffold Ga0211539_10106308

Overview

Basic Information

• Taxon OID: 3300020437
• Scaffold ID: Ga0211539_10106308
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1130
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_041
• Coordinates
  • Lat. (^o): 14.5
  • Long. (^o): 70.0
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009035	Metagenome / Metatranscriptome	324	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211539_101063082	F009035	GGA	MILQILFCLLIILYWFSEGVTEGWTWSTKKRKETNKLIHPNNKSNGIFDYHMWRILENVGIWGAVIVAFLMEASFSKFFWLGVGSWFIGTFCYEAALNHVNKGTIYKPVDYKWHILGYDIPWWGGKRIFILPAVGLAVLIYGVLI