Scaffold Ga0211565_10035126

Overview

Basic Information

• Taxon OID: 3300020433
• Scaffold ID: Ga0211565_10035126
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2128
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (28.57%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_138
• Coordinates
  • Lat. (^o): 6.3315
  • Long. (^o): -102.9484
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085581	Metagenome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211565_100351262	F085581	AGAAG	MTKALPKISNPKLPPNVKVFQDHLALGLECFDLDWFDFRPHTCKNKEYGNGLLFSQVKGVSAKFAAEFSIIVSNQGLHLPNEKILPFTNEQPPTKMALLVLSAMVNEQPLHFECPQCD