Basic Information | |
---|---|
Taxon OID | 3300020433 Open in IMG/M |
Scaffold ID | Ga0211565_10005139 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5774 |
Total Scaffold Genes | 13 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (69.23%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_138 | |||||||
Coordinates | Lat. (o) | 6.3315 | Long. (o) | -102.9484 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F042935 | Metagenome | 157 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211565_100051394 | F042935 | AGGAG | MFNYHNIIRQLEAMSPAHQDEFAQVLIEKNSGLAAAISTKINIAHQDKYYTDTEAMDASLKSRGHA |
⦗Top⦘ |