Scaffold Ga0211556_10507365

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211556_10507365

Scaffold Ga0211556_10507365

Overview

Basic Information
Taxon OID	3300020432 Open in IMG/M
Scaffold ID	Ga0211556_10507365 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100002052 (ERX556103-ERR599100)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	529
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	TARA_142
Coordinates	Lat. (^o)	25.7109	Long. (^o)	-88.4916	Alt. (m)		Depth (m)	125
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002185	Metagenome / Metatranscriptome	585	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211556_105073652	F002185	N/A	GVIMVKGKLERKYKLIHNGRELSKGLLSEAGKYDAFQILVQKFDEGVPDAIDPDEVEVIDVTQEKS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.