| Basic Information | |
|---|---|
| Taxon OID | 3300020432 Open in IMG/M |
| Scaffold ID | Ga0211556_10278551 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100002052 (ERX556103-ERR599100) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 756 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_142 | |||||||
| Coordinates | Lat. (o) | 25.7109 | Long. (o) | -88.4916 | Alt. (m) | Depth (m) | 125 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021559 | Metagenome / Metatranscriptome | 218 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211556_102785511 | F021559 | GGAG | MTDHAPIDQPILEILNTYNPLEIKDILLHGSWRKATKHKDWDKVLAYYKDNIDYMHHYLLDSPDAWNHYGMMQKAYTMTDHTPQDQKDYIKDVFYLYLDVLAADIGHKWDLHSRPRKEIEDEVLAIEL |
| ⦗Top⦘ |