Scaffold Ga0211554_10007897

Overview

Basic Information

• Taxon OID: 3300020431
• Scaffold ID: Ga0211554_10007897
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6889
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (37.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_145
• Coordinates
  • Lat. (^o): 39.2173
  • Long. (^o): -72.0327
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095741	Metagenome / Metatranscriptome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211554_100078978	F095741	AGG	MKNKILVLISLISFPSFIQALSYEVRGIERVSQMFGDAICVSLYITNNTRNTYSFNIFAIDAKGDGLTSTPSLFVSKKPDFNPNQDLTANSKARGWLCFDEPEYGWVPETIEFSEVWGSKFLTVYVN