Scaffold Ga0211622_10098402

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211622_10098402

Scaffold Ga0211622_10098402

Overview

Basic Information
Taxon OID	3300020430 Open in IMG/M
Scaffold ID	Ga0211622_10098402 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1266
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location Name	TARA_123
Coordinates	Lat. (^o)	-8.8951	Long. (^o)	-140.3174	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060828	Metagenome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211622_100984024	F060828	N/A	MNKFNGHEAYIISKALDLYVNAMTEEIESIEATGKTPLFTKDYFPQLSKDIKTKLTFNTLKQDGNME

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.