Scaffold Ga0211549_10167525

Overview

Basic Information

• Taxon OID: 3300020425
• Scaffold ID: Ga0211549_10167525
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001765 (ERX556083-ERR598964)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 864
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_149
• Coordinates
  • Lat. (^o): 34.155
  • Long. (^o): -49.6942
  • Depth (m): 740

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040678	Metagenome / Metatranscriptome	161	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211549_101675251	F040678	N/A	QVNYLAGHKSMAMTKRYDHANEERYGAAIETLDAAGKTGSAEALAAARWKRT