NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211549_10005281

Scaffold Ga0211549_10005281


Overview

Basic Information
Taxon OID3300020425 Open in IMG/M
Scaffold IDGa0211549_10005281 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100001765 (ERX556083-ERR598964)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4768
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (22.22%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_149
CoordinatesLat. (o)34.155Long. (o)-49.6942Alt. (m)Depth (m)740
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012354Metagenome281Y

Sequences

Protein IDFamilyRBSSequence
Ga0211549_100052819F012354N/APMAKKAIVSRNSVGLPVFLNPIYEITPIIIPTEKPIRFRIISNKNSNVANLLAVLNKV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.