Scaffold Ga0211620_10430783

Overview

Basic Information

• Taxon OID: 3300020424
• Scaffold ID: Ga0211620_10430783
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 558
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → unclassified Rhodobacterales → Rhodobacterales bacterium TMED271 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_048
• Coordinates
  • Lat. (^o): -9.4112
  • Long. (^o): 66.3281
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084330	Metagenome / Metatranscriptome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211620_104307831	F084330	N/A	KNIFGKAFYSNLWIAISFGLISQIIGYTKYEGYFDLYWIIMKDGYLYFNLYPSFDELNAVLFIRVFLAVFVFLTVKDKLKGN