Scaffold Ga0211620_10245998

Overview

Basic Information

• Taxon OID: 3300020424
• Scaffold ID: Ga0211620_10245998
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 764
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula → Rhodopirellula sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_048
• Coordinates
  • Lat. (^o): -9.4112
  • Long. (^o): 66.3281
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037256	Metagenome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211620_102459983	F037256	GAG	MKKLYMFSKTVAVTEETQVEAKSYEEAVDIFLSGGGVTDEVDANGGDWECIDNPDELEEEEVV